Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CH2-domain (Fragment)
  • GlycoProtDB:GPDB0005336
  • UniProt:Q5R3X8
  • Gene Symbol: No data
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
67 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

APNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIK

Feature

GlyTouCan Images

No data