Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Calcium-activated potassium channel subunit beta-1
  • GlycoProtDB:GPDB0005345
  • UniProt:Q5SQK1
  • Gene Symbol: Kcnmb1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
80 22823882
142 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKSVWTQESICHLIETNIKDQEELEGKKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALADVKKVRANFYKHHEFYCLSAPQVNETSVVYQRLYGPQVLLFSFFWPTFLLTGGLILIAMVKLNRSLSILAAQK

Feature

GlyTouCan Images

No data