Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1 type I procollagen (Fragment)
  • GlycoProtDB:GPDB0005412
  • UniProt:Q60785
  • Gene Symbol: Col1a1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
226 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

PRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGTPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGDRYYRADDANVVRDRDLAVDATLKSLSQQIENIRSPXSSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMTDGFPFEYGSEGSDPTDVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIELRGEGNSRFTYSRVVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPDQEFGLDIGPXCFV

Feature

GlyTouCan Images

No data