Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: ADAM 4 protein (Fragment)
  • GlycoProtDB:GPDB0005416
  • UniProt:Q60815
  • Gene Symbol: Adam4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
366 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

FGVWKSKEFARFEPLQLFSLHQRPKNTDYGSFQNGLCNPNWGYITYVGKNHLFLAGSFLAHAVGHLLDVSHDTPGCVCFRRSSCLMDEFPTLHDMISNCSHNELHRRIHDWDPCLSLELKTAKEVNMYEVPRCGNKRVEASEKCDCGSVKDCTTDKCCEVNCEFTQGSSCAAGGCCLSCKFAPTGTICRDKNGICDLPEYCSGASEHCPGNFYIMDGTPCSPLAVCIAGNCSDRHLQCQALFGYQVKDGSPACYNELNVKGDRFGNCGIGIIRGGSQPVPCQKEDVFCGMIHCDGVSHIPGGGEHTTFYHLKVQDVKEEQCFGYDAHHGTELPEMGLVVDGATCGPGKYCKAQRCVAHPTLNFNCNISSCNFRGVCNNKGNCHCVRGWQPPHCLQIGKGGSTNSGPPPTTQKKHQAEIHVSANRLIVILSIRMILILASILLGAVLKAIFVSETTEEEQHSAVNRQLTSYQTI

Feature

GlyTouCan Images

No data