Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: B7-2 protein
  • GlycoProtDB:GPDB0005465
  • UniProt:Q61238
  • Gene Symbol: Cd86
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
97 23002422
151 22823882
23002422
159 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MYVIKTCATCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE

Feature

GlyTouCan Images

No data