Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Apolipoprotein C-IV
  • GlycoProtDB:GPDB0005466
  • UniProt:Q61268
  • Gene Symbol: Apoc4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
107 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSLLRCRPRDLPSVSLSVLFLVSFVASMSTESLSPTPGPESSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQGFMQTYYEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCKDRTQG

Feature

GlyTouCan Images

No data