Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Basic domain/leucine zipper transcription factor (Fragment)
  • GlycoProtDB:GPDB0005472
  • UniProt:Q61340
  • Gene Symbol: Gnptab
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
43 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

ILTTQKAYESLVSPVTPLPQADVPFEDVPKEKRFPKIRRHDVNATGRFQEEVKIPRVNISLLPKEAQVRLSNLDLQLERGDITLKGYNLSKSALLRSFLGNSLDTKIKPQARTDETKGNLEVPQENPSHRRPHGFAGEHRSERWTAPAETVTVKGRDHALNPPPVLETNARLAQPTLGVTVSKENLSPLIVPPESHLPKEEESDRAEGNAVPVKELVPGRRCSRIIQAFCPGKKKKYFQDLLDAEESLKTQLAYFTDSKHTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFHEVDTDQSGVLSDREIRTLATRIHDLPLTCRI

Feature

GlyTouCan Images

No data