Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1-acid glycoprotein (AGP) (Fragment)
  • GlycoProtDB:GPDB0005506
  • UniProt:Q61613
  • Gene Symbol: Orm1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
21 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

SQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELQEVFQKAVTHVGMDESEIIFVDWKKDRCS

Feature

GlyTouCan Images

No data