Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: B7-2 protein
  • GlycoProtDB:GPDB0005633
  • UniProt:Q64381
  • Gene Symbol: B7-2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
139 23002422
193 22823882
23002422
201 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAKTIRRLSVAFLTLSDRGPHYKILLPLPHKGWTPGLTHNASLYCASIILKNTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE

Feature

GlyTouCan Images

No data