Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha 2,8-sialyltransferase
  • GlycoProtDB:GPDB0005641
  • UniProt:Q64468
  • Gene Symbol: St8sia1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
56 17406563
22823882
230 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAMLARKFPRTRLPVGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLAQRTAWRTNQTSASLFRRQMEDCCDPAHLFAMTKMNSPMGKSLWYDGELLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKMSGCARQIDEPNFVMRCNLPPLSSEYTRDVGSKTQLVTANPSIIRQRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLKDVGANQTVLFANPNFLRNIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVNMQGDPISHHYYDNVLPFSGYHAMPEEFLQLWYLHKIGALRMQLDPCEEPSPQPTS

Feature

GlyTouCan Images

No data