Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase
  • GlycoProtDB:GPDB0005654
  • UniProt:Q64676
  • Gene Symbol: Ugt8
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
78 17406563
22823882
442 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKSYTPYFMLLWSAVGIARAAKIIIVPPIMFESHLYIFKTLASALHERGHHTVLLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVYLISRIGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVSGAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTTYWIDYILRHDGARHLRSAVHQISFCQYFLLDIAFVLLLGAVLLYFILSYVTKFIYRKIKSLWSKNEHSTVNGHYQNGIRNGKYKGNGRVKHEKKVR

Feature

GlyTouCan Images

No data