Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Autophagy-related protein 9A
  • GlycoProtDB:GPDB0005680
  • UniProt:Q68FE2
  • Gene Symbol: Atg9a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
99 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFTCMLIGEMFELMQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAGVFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEVVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTVCRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGVHLGGVAESHRHTPHSHLLPPPSGPGDHRLLPQLYGRGRGCGRHLLLCSDGRSPAWPSSVAVWRADRGLSVPASRGREDRVVAHALCHHQSRLAAPS

Feature

GlyTouCan Images

No data