Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cathepsin L (Fragment)
  • GlycoProtDB:GPDB0005744
  • UniProt:Q6LAF5
  • Gene Symbol: Ctsl
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
87 17406563
22823882
134 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

CGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSW

Feature

GlyTouCan Images

No data