Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cathepsin B (Fragment)
  • GlycoProtDB:GPDB0005745
  • UniProt:Q6LAF6
  • Gene Symbol: Ctsb
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
104 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

CGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTKKGLVSGGVYDSHIGCLPYTIPPCEHHVNGSRPPMHGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAAN

Feature

GlyTouCan Images

No data