Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha 4 integrin (Fragment)
  • GlycoProtDB:GPDB0005939
  • UniProt:Q78E20
  • Gene Symbol: Itga4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
5 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

QPGENGSIVTCGHRWKNIFYMKSDNKLPTGICYVMPSDLRTELSKRMAPCYKDYTRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGTVFVYNITTNQYKAFVDRQNQVKFGSYLGYSVGAGHFRSPHTTEVVGGAPQHEQIGKAYIFSIDENELNIVYEMKGKKLGSYFG

Feature

GlyTouCan Images

No data