Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Adenosine monophosphate-protein transferase FICD
  • GlycoProtDB:GPDB0006220
  • UniProt:Q8BIX9
  • Gene Symbol: Ficd
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
275 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MILMPMASVVAVAEPKWVSVWGRFLWMALLSMALGSLLALLLPLGVVEEHCLAVLRGFHLLRSKLDRAQPVVPKCTSLCTELSVSSRDAGLLTVKTTASPAGKLEAKAALNQALEMKRQGKRGKAHKLFLHALKMDPGFVDALNEFGIFSEEDKDIIQADYLYTRALTISPFHEKALVNRDRTLPLVEEIDQRYFSVIDSKVKKVMSIPKGSSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTMDDMLEIHRRVLGYVDPVEAGRFRRTQVLVGHHIPPHPRDVEKQMQEFTQWLNSEDAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSEYYHVLEVANEGDVRPFIRFIAKCTEVTLDTLLLATTEYSVALPEAQPNHSGFKETLPVRP

Feature

GlyTouCan Images

No data