Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 9530003J23Rik protein
  • GlycoProtDB:GPDB0006285
  • UniProt:Q8BM26
  • Gene Symbol: 9530003J23Rik
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
62 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKAPLTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFNTNTTRFNPEDQSTSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRIVKDPQGIYSWAGWIKHCKNKNLKEYIRGCHL

Feature

GlyTouCan Images

No data