Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C-type lectin domain family 4 member G
  • GlycoProtDB:GPDB0006321
  • UniProt:Q8BNX1
  • Gene Symbol: Clec4g
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
73 23002422
93 23002422
246 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MNTGEYNKLGSAIEEVSRGQLGRWECYKQRLFFLVLALLVATVLWALILSTLLSSASSKLRVLLSHQDLLRTNASEQKMTLSSLKDDIGACRNCCSVTKAQLQTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASRDRENIRSELFQALEAVKRQNSSCEQCPPSWLPFQGSCYYFSETQATWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTRGRGYWLGLRAVRHLNKIQGYRWVDGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICEKRSSCY

Feature

GlyTouCan Images

No data