Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Bis(5'-adenosyl)-triphosphatase enpp4
  • GlycoProtDB:GPDB0006382
  • UniProt:Q8BTJ4
  • Gene Symbol: Enpp4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
131 22823882
23002422
148 22823882
23002422
156 22823882
23002422
169 23002422
279 17406563
22823882
23002422
330 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MFNMKILVIPLFWGLVTGYKGNSSDSSAPRLLLVSFDGFRADYLKSYDLPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDSVTKKHFSESNDKDPFWWNGAEPIWVTNQLQENRSSAAAMWPGTDVPIHNITASYFMNYSSSVSFKERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHKYGPEDKENMRRVLKEVDDLIGDIVLKLKVLGLWDSLNVIITSDHGMAQCSKNRLIDLDSCIDRSNYSVIDLTPVAAILPKINVTEVYDKLKRCNPHMNVYLKEAIPNRFYYQHSSRIQPIILVAEEGWTITLNKSSFKLGDHGYDNSLPSMHPFLAAHGPAFRKGYRQSTINTVDIYPMMCHILGLKPHPNNGTLSHTKCLLVDQWCINLPEAIGIVVSALLVLTMLTGLMIFMRSRASTSRPFSRLQLQEDDDDPLID

Feature

GlyTouCan Images

No data