Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Acid phosphatase type 7
  • GlycoProtDB:GPDB0006418
  • UniProt:Q8BX37
  • Gene Symbol: Acp7
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
404 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSPFLGGWLFFCMLLPFSPGVQGAQEYPHVTPEQIHLSYLGEPGTMTVTWTTWAPARSEVQFGSQLSGPLPFRAHGTARAFVDGGVLRRKLYIHRVTLRKLQPGAQYVYRCGSSQGWSRRFRFTALKNGVHWSPRLAVFGDMGADNPKALPRLRRDTQQGMFDAVLHVGDFAYNMDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEQRYNFSNYKARFSMPGDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLIEKQFRWLENDLQKANKNRVARPWIITMGHRPMYCSNADLDDCTRHESRVRKGLHGKLFGLEDLFHKYGVDLEFWAHEHSYERLWPIYNYQVFNGSLESPYTNPRGPVHIITGSAGCEELLTPFVRKPRPWSAVRVKEYGYTRMHILNGTHMHIQQVSDDQDGKIVDDVWVVRPLLGRMMYH

Feature

GlyTouCan Images

No data