Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Biotinidase
  • GlycoProtDB:GPDB0006678
  • UniProt:Q8CIF4
  • Gene Symbol: Btd
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
96 17406563
22823882
127 17406563
22823882
180 17406563
22823882
326 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSGARTAPALFFLGCSALALGVSSASQEHREAEYYVAAVYEHPSVLSPNPLELVSRQEALELMKQNLDVYEQQVMAAAQKGVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPKLVRWNPCLEPFRFNDTEVLQRLSCMAIKGGMFLVANLGTKQPCLSSDPGCPQDGRYQFNTNVVFSDNGTLVDRYRKHNLYFEAAFDTPANVDLITFDTPFAGKFGVFTCFDILFFDPAVRLLRDFEVKHIVYPTAWMNQLPLLAAIEIQKAFATAFGVNVLAANIHHPTLGMTGSGIHTPLKSFWYHDMDDPKGHLIIAQVATNPQGLTGTGNTTSEMDPSHRKFLKILSGDPYCEKDAQEVHCDEAAKWNVNVPPTFHSEMMYDNFTLVPVWGTEGHLQVCSNSLCCHLLYERPTLSKELYALGVFDGLHTVHGTYYIQTCALVKCGGLGFDTCGQEITEAEGLFDFHLWGNFSTLYIFPLFLTSGMTLDTPDQLGWENDHYFLRKRGLSSGLVTAALYGRLYERK

Feature

GlyTouCan Images

No data