Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD209 antigen-like protein B
  • GlycoProtDB:GPDB0006698
  • UniProt:Q8CJ85
  • Gene Symbol: Cd209b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
112 23002422
141 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSDSTEAKMQPLSSMDDDELMVSGSRYSIKSSRLRPNSGIKCLAGCSGHSQVPLVLQLLSFLFLAGLLLIILFQVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELYLPAADF

Feature

GlyTouCan Images

No data