Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C-type lectin domain family 4, member a3
  • GlycoProtDB:GPDB0006715
  • UniProt:Q8JZX6
  • Gene Symbol: Clec4a3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
86 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MFSENIYVNTNFKNKVDSSDIDTDSWPAPQRKNTSQKSCHKFSKVLFTSLIIYFLLLTILFSGALITLFTKYSQLLEEKMIIKELNYTELECTKWASLLEDKVWSCCPKDWKPFGSYCYFTSTDLVASWNESKENCFHMGAHLVVIHSQEEQDFITGILDTGTAYFIGLSNPGDQQWQWIDQTPYDDNTTFWHKGEPSSDNEQCVIINHRQSTGWGWSDIPCSDKQNSICHVKKIYL

Feature

GlyTouCan Images

No data