Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 4732418C07Rik protein (Fragment)
  • GlycoProtDB:GPDB0006817
  • UniProt:Q8R053
  • Gene Symbol: Efcab14
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
125 17406563
22823882
23002422
148 22823882
169 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

LKASVKSAADLLSLPSTVEGLQKSVASIGNTLNSVHLAVEVIQKTVDEHRTTLGLLQGSMENNGSNQILPSPSPPSELDNKSHSESAKQDILYLHNSLEEVNSTVVEYQRQNDLKLKGMSETLSNLTQRLSLIESHVVALSKAEQRTNVSSSTMENRAATLKRESLVTNRSDTVQAQSMKKEDNSNSQVSELREKLQLISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPLSLPGISSIKDLQDLFHKTGQDVDGMLTYQELWNSLGSAMPRPESLRAFDSNGDGRYSFLELRLALGI

Feature

GlyTouCan Images

No data