Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 2210023G05Rik protein (Fragment)
  • GlycoProtDB:GPDB0006845
  • UniProt:Q8R1G9
  • Gene Symbol: Ces2g
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
83 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

YMEDIEDPKTLQIQFTEMMEDFMFVIPSLQVAYFQRSHAPVYFYEFQHQSSFLKDVRPPHVNADHGDEVPFVFGSFFWGMKLNLTEEEKLLNRRMMKYWANFARHGNPNSESLPYWPVFDHDEQYLQLNIQPAVGQFQKARKLQFWTKTLPRKIEELKRSQNVHKEL

Feature

GlyTouCan Images

No data