Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Abca7 protein (Fragment)
  • GlycoProtDB:GPDB0006847
  • UniProt:Q8R1I3
  • Gene Symbol: Abca7
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
162 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

GARPQESDQPTSQGSVTKLLEKILQRASLDPVLGQAQDSMRKFSDAIRDLAQELLTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEANQLNEFMGPEVAPALPDNSLSPACSEFVGTLDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKLEAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERRLWAGIVFLSPTRPKQ

Feature

GlyTouCan Images

No data