Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Bone marrow stromal antigen 2
  • GlycoProtDB:GPDB0006859
  • UniProt:Q8R2Q8
  • Gene Symbol: Bst2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
70 17406563
22823882
23002422
97 ---

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAPSFYHYLPVPMDEMGGKQGWGSHRQWLGAAILVVLFGVTLVILTIYFAVTANSVACRDGLRAQAECRNTTHLLQRQLTRTQDSLLQAETQANSCNLTVVTLQESLEKKVSQALEQQARIKELENEVTKLNQELENLRIQKETSSTVQVNSGSSMVVSSLLVLKVSLFLLF

Feature

GlyTouCan Images

No data