Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: BC021785 protein (Fragment)
  • GlycoProtDB:GPDB0006932
  • UniProt:Q8VC53
  • Gene Symbol: Mfsd4b5
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
90 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

GRVGPDRTKNPLFGASKLESEMGSRGSGPTSVEQHLLQVETQGKNGLQAVGRTLRWFTTVVLNAAFLGMGVSAAVLGPTFPDLARNVNRNVSSLSEIFVGRALGYLCGSVVGGVLFDCMNHFLLLGLSNLLTIAGLYLTPFCKTAALLTTMMSVTGVSFGVLDTDRIFLRRPPKCCN

Feature

GlyTouCan Images

No data