Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C-type lectin domain family 14 member A
  • GlycoProtDB:GPDB0006956
  • UniProt:Q8VCP9
  • Gene Symbol: Clec14a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
189 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MRPALALCLLCPAFWPRPGNGEHPTADRAACSASGACYSLHHATFKRRAAEEACSLRGGTLSTVHSGSEFQAVLLLLRAGPGPGGGSKDLLFWVALERSISQCTQEKEPLRGFSWLHPDSEDSEDSPLPWVEEPQRSCTVRKCAALQATRGVEPAGWKEMRCHLRTDGYLCKYQFEVLCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPGDLSVSSTCIQEETSAHWDGLFPGTVLCPCSGRYLLAGKCVELPDCLDHLGDFTCECAVGFELGKDGRSCETKVEEQLTLEGTKLPTRNVTATPAGAVTNRTWPGQVYDKPGEMPQVTEILQWGTQSTLPTIQKTPQTKPKVTGTPSGSVVLNYTSSPPVSLTFDTSSTVVFILVSIAVIVLVVLTITVLGLFKLCFHKSRSSRTGKGALDSPGVECDAEATSLHHSSTQCTDIGVKSGTVA

Feature

GlyTouCan Images

No data