Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD276 antigen
  • GlycoProtDB:GPDB0006983
  • UniProt:Q8VE98
  • Gene Symbol: Cd276
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
189 23002422
215 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA

Feature

GlyTouCan Images

No data