Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD14 antigen (Fragment)
  • GlycoProtDB:GPDB0007033
  • UniProt:Q91VC2
  • Gene Symbol: CD14
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
170 23002422
266 22823882
307 ---

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

LLVRASPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKYNSGVVTAGAPSSQAVALSGTLALLLGDRLFV

Feature

GlyTouCan Images

No data