Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1-acid glycoprotein
  • GlycoProtDB:GPDB0007073
  • UniProt:Q91X23
  • Gene Symbol: Orm1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
94 17406563
22823882
23002422
104 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELQEVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA

Feature

GlyTouCan Images

No data