Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carbohydrate sulfotransferase 15
  • GlycoProtDB:GPDB0007088
  • UniProt:Q91XQ5
  • Gene Symbol: Chst15
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
142 23002422
208 23002422
409 23002422
441 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MRHCINCCVQLFPEDTHKQQVACQGGPHHSHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFRKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSVMDGENPSDVKEHHYQPSVNNISYVKDYPSIKLIIDSIAARIEFTTRQLPDLQDLKRQELHMFSVIPSKFLPTSKSPCWYEEFSGRNTTDPYLTNSYVLYSKRFRSTFDALRKVFWGHLSHVQGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQAASAEQPSKMNKIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPEAKLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLTVFSKEQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNTRRPEDRSLGPMWPITQKILREFYGPFNTRLAQVLDDEAFAWKTT

Feature

GlyTouCan Images

No data