Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Agrin (Fragment)
  • GlycoProtDB:GPDB0007090
  • UniProt:Q91XS3
  • Gene Symbol: Agrn
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
137 ---

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MVRPRLSFPAPLLPLLLLLAAAAPAVPGATGTCPERALERRKEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGIHFTAAPSMPPDVCRGMLCGFGAVCEPSV

Feature

GlyTouCan Images

No data