Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
  • GlycoProtDB:GPDB0007103
  • UniProt:Q91Y74
  • Gene Symbol: St3gal4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
131 23002422
310 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPISEKKEPCFQGEAERQASKIFGNRSREQPIFLQLKDYFWVKTPSTYELPFGTKGSEDLLLRVLAITSYSIPESIKSLECRRCVVVGNGHRLRNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQVRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDASNKKQTIHYYEQITLKSMAGSGHNVSQEAIAIKRMLEMGAVKNLTYF

Feature

GlyTouCan Images

No data