Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Adamtsl4 protein
  • GlycoProtDB:GPDB0007111
  • UniProt:Q91YP4
  • Gene Symbol: Adamtsl4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
107 22823882
113 22823882
162 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGPCTTAWFYSDWSSKCSAECGTGIQRRAVVCLRSGETLQGDPEAGSTEQGCPLRSRPPDMRACSLGPCERTWRWFTGPWSECSSECGSGTQHRDIICVSKLGAEFNVTSPSNCSHLPRPPALQPCQGQACEDKWFSTLWSPCSRSCQGGMQTREVQCLSGNQTLSSRCPPHLRPSRKRPCNSQPCNQRPDDQCKDSSPHCPLVVQARLCVYPYYTTTCCRSCAHVLEQSQLEPA

Feature

GlyTouCan Images

No data