Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD86 antigen
  • GlycoProtDB:GPDB0007116
  • UniProt:Q91YV7
  • Gene Symbol: Cd86
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
92 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLDQNVTGNSGINLTCMSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSAQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE

Feature

GlyTouCan Images

No data