Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD209 antigen-like protein D
  • GlycoProtDB:GPDB0007131
  • UniProt:Q91ZW8
  • Gene Symbol: Cd209d
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
114 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSDSMESKTQQVVIPEDEECLMSGTRYSDISSRLQTKFGIKSLAEYTKQSRNPLVLQLLSFLFLAGLLLIILILVSKVPSSEVQNKIYQELMQLKAEVHDGLCQPCARDWTFFNGSCYFFSKSQRNWHNSTTACQELGAQLVIIETDEEQTFLQQTSKARGPTWMGLSDMHNEATWHWVDGSPLSPSFTRYWNRGEPNNVGDEDCAEFSGDGWNDLSCDKLLFWICKKVSTSSCTTK

Feature

GlyTouCan Images

No data