Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Ashwin
  • GlycoProtDB:GPDB0007161
  • UniProt:Q922M7
  • Gene Symbol: No data
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
169 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAGDVGGRSCTDAELLLHPELLSQEFLLLTLEQKNIAVENEVRVNKDNLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREHHEVKNDTKRSSAVDGLRKRPLIVFDGSSTSTSIKVKRTENGADDRLKPLAQIGSTSDAFWKSPNSSSRISPLVLFSNLPVNHKMEHNNNDTQQNHDLMNRKSPSGPVKSPPLSPVGTTPVKLKRAAPKEEAEATNHLKPPEVKRKIQHVTWP

Feature

GlyTouCan Images

No data