Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cathepsin H
  • GlycoProtDB:GPDB0007164
  • UniProt:Q922Q7
  • Gene Symbol: Ctsh
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
99 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MWAALPLLCAGAWLLSTGATAELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVINQGACGSCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Feature

GlyTouCan Images

No data