Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carcinoembryonic antigen family member protein
  • GlycoProtDB:GPDB0007195
  • UniProt:Q99232
  • Gene Symbol: Ceacam1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
195 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MELASAHLHKGQVPWVGLLLTASLLASWSPPTTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNPVSTNAEIVHFVTGTNKTTTGPAHSGRETVYSNGSLLIQRVTVKDTGVYTIEMTDENFRRTEATVQFHVHQPVTQPSLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVKRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGSGSF

Feature

GlyTouCan Images

No data