Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cannabinoid receptor 1 (Fragment)
  • GlycoProtDB:GPDB0007263
  • UniProt:Q99NU3
  • Gene Symbol: Cnr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
26 17406563
22823882
32 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

FRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFC

Feature

GlyTouCan Images

No data