Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Adipocyte plasma membrane-associated protein
  • GlycoProtDB:GPDB0007398
  • UniProt:Q9D7N9
  • Gene Symbol: Apmap
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
159 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSEADGLRQRRPLRPQVVTDDGQVPEVKEGSSFSGRVFRMTFLMLAVSLAIPLLGAMMLLESPIDPQSFSFKEPPFMFGVLHPNTKLRQAERLFENQLSGPESIVNIGDVLFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPTCGRPLGIRAGPNGTLFVVDAYKGLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKMFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPFICRLSLQSI

Feature

GlyTouCan Images

No data