Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 1700074P13Rik protein
  • GlycoProtDB:GPDB0007422
  • UniProt:Q9D9G7
  • Gene Symbol: 1700074P13Rik
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
91 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKTFFIFTLLSLAVANTPKAVLKEYNNSEEYLPENFNVPYMVYLQSSPEPCVGTLIDPQWVLTAAHCSLPTKIRLGVYRPNIKNEKEQICNYSFTVVHPNFDAKLLKNDLMLIKLSYPATINMYVGTIAIAMEPMAFNESCFIPTWTWNNYKNLSDPDILTWINEYSLSPSDCLDTLHQQKQETRINIMCIGHSLNAMSATKEVSAAPAICSGRVHGILSWGKASVANGSKGFFTEIHPYARWILKMIRSH

Feature

GlyTouCan Images

No data