Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD302 antigen
  • GlycoProtDB:GPDB0007481
  • UniProt:Q9DCG2
  • Gene Symbol: Cd302
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
107 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MPHAALSSLVLLSLATAIVADCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAAIPYDKKYLSDNHILISTLVIASTVTLAVLGAIIWFLYRRNARSGFTSFSPAPLSPYSDGCALVVAEEDEYAVQLD

Feature

GlyTouCan Images

No data