Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carbohydrate sulfotransferase 1
  • GlycoProtDB:GPDB0007505
  • UniProt:Q9EQC0
  • Gene Symbol: Chst1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
189 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLTDTGLAERLCEEGPTFSYNLSRKTHVLILATTRSGSSFVGQLFNQHMDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDLLRSLYDCDLYFLENYIKPPPVNHTTNRVFRRGASRVLCSRPVCDPPGSSDLILEEGDCVRMCGLLNLTLAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSSSVSTGLMRPSWLKGKYMLVRYEDLARNPMKKTEEIYEFLGIPLDSHVAHWIQNNTRGDPTLGKHKYSTVRNSAATAEKWRFRLSYDIVAFAQNACQQVLAQLGYKMANSEEELKNPAISLVEERDFRPFL

Feature

GlyTouCan Images

No data