Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Brain cDNA, clone MNCb-1208, similar to Mus musculus mitogen activated protein kinase kinase 1 (Map2k1), mRNA
  • GlycoProtDB:GPDB0007567
  • UniProt:Q9JJE1
  • Gene Symbol: Map2k1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
21 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGGPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI

Feature

GlyTouCan Images

No data