Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C-type lectin domain family 1 member B
  • GlycoProtDB:GPDB0007599
  • UniProt:Q9JL99
  • Gene Symbol: Clec1b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
120 17406563
22823882
23002422
134 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVALGIMSVTQQKYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHKCSPCATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERNAGMTRVDQLL

Feature

GlyTouCan Images

No data