Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-N-acetylgalactosaminidase
  • GlycoProtDB:GPDB0007654
  • UniProt:Q9QWR8
  • Gene Symbol: Naga
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
177 17406563
22823882
23002422
201 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MLQKTVLLLALVAQVLMLENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIGGRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLLMSTDLRTISPQNMDILQNPLMIKINQDPLGIQGRRILKSKSHIEVFKRYLSNQASALVFFSRRTDMPFRFHCSLLELNYPKGRVYEGQNVFTGDIFSGLQTEVNFTVIINPSGVVMWYLYPIKDLGISTMMSHW

Feature

GlyTouCan Images

No data