Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Adhesion protein RA175N
  • GlycoProtDB:GPDB0007675
  • UniProt:Q9QYL3
  • Gene Symbol: Cadm1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
18 22823882
157 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYPCEASNIVGKAHSDYILYVYDTTATTEPAVHDSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI

Feature

GlyTouCan Images

No data